DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and CLEC4F

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_011530937.1 Gene:CLEC4F / 165530 HGNCID:25357 Length:699 Species:Homo sapiens


Alignment Length:124 Identity:32/124 - (25%)
Similarity:51/124 - (41%) Gaps:35/124 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRS 105
            |||   ..:.:|.||...|...||.||:|.::|:...::.:.:   :::    :|:|   |.||.
Human   592 YFS---SVKKSWHEAEQFCVSQGAHLASVASKEEQAFLVEFTS---KVY----YWIG---LTDRG 643

  Fly   106 Y--FWTWMSTGIPVTYAQWSRREPKSD-----------RTGQDACLVLGTDNLWHSEPC 151
            .  .|.| :.|.|...||  .:.|.|.           .:|..||..:.|      .||
Human   644 TEGSWRW-TDGTPFNAAQ--NKAPGSKGSCPLRKYIIVNSGMGACSFIDT------PPC 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 29/116 (25%)
CLEC4FXP_011530937.1 CCDC158 <207..>581 CDD:464943
CLECT_DC-SIGN_like 581..>657 CDD:153060 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.