DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Fcer2a

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_006508760.1 Gene:Fcer2a / 14128 MGIID:95497 Length:335 Species:Mus musculus


Alignment Length:145 Identity:34/145 - (23%)
Similarity:71/145 - (48%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFG 90
            |.|.|||       .||   |.....|::|...|:.:...|.::.::::...::.::|:|:.   
Mouse   195 LHFQQKC-------YYF---GKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDS--- 246

  Fly    91 NRTFWLGATNL-VDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRK 154
                |:|..:| ::..:.|   |.|.||.|:.|:..||.:...|:| |:::.....|:...|:..
Mouse   247 ----WIGLQDLNMEGEFVW---SDGSPVGYSNWNPGEPNNGGQGED-CVMMRGSGQWNDAFCRSY 303

  Fly   155 HN-FICENV--CQLN 166
            .: ::||.:  |:::
Mouse   304 LDAWVCEQLATCEIS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 23/112 (21%)
Fcer2aXP_006508760.1 COG4372 54..>179 CDD:443500
CLECT_DC-SIGN_like 190..310 CDD:153060 31/135 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.