DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Asgr2

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_031519.1 Gene:Asgr2 / 11890 MGIID:88082 Length:301 Species:Mus musculus


Alignment Length:161 Identity:41/161 - (25%)
Similarity:72/161 - (44%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NNTDLTFYQKCNPL----LQCN-AYFSVAG--FAEVNWLEANHVC---NRVGAVLATV----RNE 72
            :::.|.|:.|..|:    |.|. |||...|  ...|||:|....|   :|.|...|..    :.|
Mouse   137 DHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLE 201

  Fly    73 EQHQLMLHYVNRKERIFGNRT---FWLGATNLVDRSYFWTWM-STGIPVTYAQWSRREPKS---- 129
            ..|.|:::....::.:..:|:   .|:|   |.||...|.|: .|.....|..|:..:|.:    
Mouse   202 NAHLLVINSREEQDFVVKHRSQFHIWIG---LTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGH 263

  Fly   130 DRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            ::.|.:.|..:.:|..|:...||:.:.::||
Mouse   264 EQGGGEDCAEILSDGHWNDNFCQQVNRWVCE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 29/125 (23%)
Asgr2NP_031519.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Lectin_N 4..162 CDD:461106 7/24 (29%)
CLECT_DC-SIGN_like 170..295 CDD:153060 31/128 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.