DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and vcana

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_021331663.1 Gene:vcana / 116993 ZFINID:ZDB-GENE-011023-1 Length:8936 Species:Danio rerio


Alignment Length:126 Identity:35/126 - (27%)
Similarity:53/126 - (42%) Gaps:18/126 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATN-L 101
            |..||.    ...||..|...|...||.||:|.:.::.|    |:||    .|:...|:|..: :
Zfish  8709 CYKYFP----HRRNWDTAERECRLQGAHLASVLSHDEQQ----YINR----LGHDYQWIGLNDKM 8761

  Fly   102 VDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVL--GTDNLWHSEPCQRKHNFICE 160
            .:..:.||   .|..|.|..|...:|.|..:..:.|:|:  ..|..|:..||.....|.|:
Zfish  8762 FENDFRWT---DGRVVQYENWRPNQPDSFFSSGEDCVVMIWHEDGQWNDVPCNYHLTFTCK 8819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 31/113 (27%)
vcanaXP_021331663.1 Ig 36..148 CDD:325142
Link_domain_CSPGs_modules_1_3 147..241 CDD:239594
Link_domain_CSPGs_modules_2_4 249..343 CDD:239597
Herpes_BLLF1 <5897..>6290 CDD:330317
EGF 8622..8652 CDD:306513
EGF_CA 8656..8692 CDD:238011
CLECT_CSPGs 8698..8821 CDD:153058 35/126 (28%)
CCP 8825..8881 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.