DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Acan

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001348429.1 Gene:Acan / 11595 MGIID:99602 Length:2170 Species:Mus musculus


Alignment Length:117 Identity:25/117 - (21%)
Similarity:53/117 - (45%) Gaps:24/117 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 WLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATN-LVDRSYFWTWMSTGI 115
            |::|...|....:.|:::...|:.:    :||:..:.:.    |:|..: .::..:.|   |.|.
Mouse  1981 WVDAERRCREQQSHLSSIVTPEEQE----FVNKNAQDYQ----WIGLNDRTIEGDFRW---SDGH 2034

  Fly   116 PVTYAQWSRREPKS-DRTGQDACLVLGTDNLWHSE------PCQRKHNFICE 160
            .:.:.:|...:|.: ..||:| |:|:    :||..      ||..:..|.|:
Mouse  2035 SLQFEKWRPNQPDNFFATGED-CVVM----IWHERGEWNDVPCNYQLPFTCK 2081

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 24/115 (21%)
AcanNP_001348429.1 Ig_Aggrecan 33..155 CDD:409481
Ig strand A 33..36 CDD:409481
Ig strand A' 39..41 CDD:409481
Ig strand B 45..53 CDD:409481
G1-A 48..140
Ig strand C 72..78 CDD:409481
Ig strand C' 83..86 CDD:409481
Ig strand D 104..109 CDD:409481
Ig strand E 115..121 CDD:409481
Ig strand F 129..136 CDD:409481
Ig strand G 146..155 CDD:409481
G1-B 152..247
Link_domain_CSPGs_modules_1_3 153..247 CDD:239594
G1-B' 253..349
Link_domain_CSPGs_modules_2_4 254..349 CDD:239597
G2-B 486..580
Link_domain_CSPGs_modules_1_3 487..581 CDD:239594
G2-B' 587..682
Link_domain_CSPGs_modules_2_4 588..683 CDD:239597
KS 685..803
PHA03307 689..>1027 CDD:223039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 737..1079
CS-1 805..1231
FhaB <849..1723 CDD:442443
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1108..1239
CS-2 1232..1917
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1299..1465
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1491..1538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1586..1671
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1782..1838
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1861..1914
EGF_CA 1918..1954 CDD:238011
CLECT_CSPGs 1960..2083 CDD:153058 25/117 (21%)
CCP 2087..2143 CDD:153056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.