DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and LOC110440085

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_021335186.1 Gene:LOC110440085 / 110440085 -ID:- Length:348 Species:Danio rerio


Alignment Length:129 Identity:36/129 - (27%)
Similarity:55/129 - (42%) Gaps:21/129 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NTDLTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKER 87
            |.|..||      .|.:.||  ....|.:|.|:...|:..||.|..|.|.|:..::       .:
Zfish   232 NKDGWFY------YQSSFYF--ISSEEKSWSESRRYCSDRGADLIIVNNSEEQDIL-------NK 281

  Fly    88 IFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTD--NLWHSE 149
            :.|....|:|.|. ..::..|||:. |..:|...||..||  :..|.:.|.|..:.  |:.||:
Zfish   282 LSGRIAVWIGLTG-SGKNRSWTWID-GTNMTTGLWSHGEP--NEAGGEICAVSRSSEWNISHSD 341

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 29/103 (28%)