powered by:
Protein Alignment CG11211 and LOC110438854
DIOPT Version :9
Sequence 1: | NP_610208.1 |
Gene: | CG11211 / 35545 |
FlyBaseID: | FBgn0033067 |
Length: | 176 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021327938.1 |
Gene: | LOC110438854 / 110438854 |
-ID: | - |
Length: | 80 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 21/74 - (28%) |
Similarity: | 30/74 - (40%) |
Gaps: | 9/74 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 FGNRTFWLGATN--LVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPC 151
|....||:|.|: :.|: |.|:....| :..|...||.| ..|.:.|..:.... |...||
Zfish 9 FAVTDFWIGLTDQEVEDK---WIWVDGSSP--FNNWQSGEPNS-HAGNEDCAQVNPWG-WADYPC 66
Fly 152 QRKHNFICE 160
.....:|||
Zfish 67 GSTFKWICE 75
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11211 | NP_610208.1 |
CLECT |
49..160 |
CDD:153057 |
19/72 (26%) |
LOC110438854 | XP_021327938.1 |
CLECT |
<13..76 |
CDD:321932 |
20/70 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.