DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and COLEC10

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_006429.2 Gene:COLEC10 / 10584 HGNCID:2220 Length:277 Species:Homo sapiens


Alignment Length:155 Identity:38/155 - (24%)
Similarity:66/155 - (42%) Gaps:28/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQ 74
            |:.|:....:.|..|:..||.    ::|          .|.|:.|:...|...|.:||..::|..
Human   141 SMKFVKNVIAGIRETEEKFYY----IVQ----------EEKNYRESLTHCRIRGGMLAMPKDEAA 191

  Fly    75 HQLMLHYVNRKE--RIFGNRTFWLGATNLV-DRSYFWTWMSTGIPV-TYAQWSRREPKSDRTGQD 135
            :.|:..||.:..  |:|      :|..:|. :..|.:|   ...|: .|:.|:..|| ||..|.:
Human   192 NTLIADYVAKSGFFRVF------IGVNDLEREGQYMFT---DNTPLQNYSNWNEGEP-SDPYGHE 246

  Fly   136 ACLVLGTDNLWHSEPCQRKHNFICE 160
            .|:.:.:...|:...|.....|:||
Human   247 DCVEMLSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 29/114 (25%)
COLEC10NP_006429.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..107
Collagen 45..111 CDD:460189
CLECT_collectin_like 157..272 CDD:153061 34/139 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.