DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and LOC100494969

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_031755235.1 Gene:LOC100494969 / 100494969 -ID:- Length:312 Species:Xenopus tropicalis


Alignment Length:122 Identity:30/122 - (24%)
Similarity:53/122 - (43%) Gaps:9/122 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRS 105
            ||||   ...:|.:|...|....:.|..:....: |..::.:.:.:.:...| ||:|.|:: :..
 Frog   195 YFSV---TSSDWFKARAFCKTKESDLVVISTAFE-QTAINNIIKAKGLELTR-FWIGLTDM-NSE 253

  Fly   106 YFWTWM-STGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPC-QRKHNFICE 160
            ..|.|: .|.....:..|...|| :|..|.:.|..:.|:..|:...| ..:.|.|||
 Frog   254 GTWEWLDGTNYNTAFKFWRAGEP-NDAGGNEDCAHIRTNGEWNDVHCTYAECNAICE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 24/112 (21%)
LOC100494969XP_031755235.1 CLECT_DC-SIGN_like 182..310 CDD:153060 30/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.