DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and pla2r1

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_031749202.1 Gene:pla2r1 / 100488773 XenbaseID:XB-GENE-1000168 Length:1473 Species:Xenopus tropicalis


Alignment Length:152 Identity:37/152 - (24%)
Similarity:55/152 - (36%) Gaps:40/152 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNR---TFWLGATNLVDRSYFWTWM 111
            ::|..|:..|...|..||:: :::.||..|       .|..||   :.|:|..| .|..|.:.| 
 Frog  1149 ISWYGASQRCQEFGGDLASI-SDQYHQAFL-------TIIANRLGYSHWIGFFN-PDNGYHFEW- 1203

  Fly   112 STGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRK-HNFIC---------------- 159
            :.|....:..|...|..||..    |..:|||..|....|..: ...:|                
 Frog  1204 ADGSKSRFTAWRDNESPSDGN----CGYIGTDGYWRGGDCDTELQGAVCLVTNETDPLDYGGECS 1264

  Fly   160 ------ENVCQLNYSGLDKRVY 175
                  :|.|....|.|||.|:
 Frog  1265 ETWIKFQNYCYSFSSVLDKTVF 1286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 30/135 (22%)
pla2r1XP_031749202.1 RICIN 58..>141 CDD:214672
FN2 185..233 CDD:128373
CLECT 253..366 CDD:153057
CLECT 386..511 CDD:214480
CLECT 526..655 CDD:214480
CLECT 684..809 CDD:214480
CLECT 828..951 CDD:214480
CLECT 974..1112 CDD:214480
CLECT 1132..1248 CDD:214480 29/112 (26%)
CLECT 1263..1389 CDD:214480 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.