DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and LOC100486944

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_031754100.1 Gene:LOC100486944 / 100486944 -ID:- Length:418 Species:Xenopus tropicalis


Alignment Length:216 Identity:46/216 - (21%)
Similarity:76/216 - (35%) Gaps:74/216 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTILFTIFSLPFLVIASS----------------------------NINNT------------- 24
            :||:|..:|.  ||:|.:|                            .||.|             
 Frog   214 LVTLLVLVFI--FLIILTSLMFIYYSTVSRQLQQEHEEKANLLTQITAINQTLDSRISEAMESIK 276

  Fly    25 -DLTFYQKCNPLLQCNAYFS-------VAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHY 81
             |:...:|..|  ||::.:.       ..|..|.||.||..:|..:.:.|..:.:|.:.:.:   
 Frog   277 QDIQTIRKERP--QCDSGWKSFDGSCYCIGSTETNWTEAQSICKSMNSDLVIIDSEREQKFL--- 336

  Fly    82 VNRKERIFGNRTFWLGATNLVDRSYFWTW-------MSTGIPVTYAQWSRREPKSDRTGQDACLV 139
                |.|..:..||:|.|...:....|.|       :|.|.      |.:.||.:: .|::.|..
 Frog   337 ----ENITDDSYFWIGLTRDNNNMNVWRWVDGTLHDLSDGF------WYKNEPNNE-DGRENCGH 390

  Fly   140 LGTDNLWHSEPCQRKHNFICE 160
            |..:..|:...|...:..|||
 Frog   391 LWKEKKWNDVFCTDLYETICE 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 27/117 (23%)
LOC100486944XP_031754100.1 CLECT_DC-SIGN_like 35..157 CDD:153060
CLECT_DC-SIGN_like 289..412 CDD:153060 31/137 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.