DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and LOC100363064

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_038945816.1 Gene:LOC100363064 / 100363064 RGDID:2324825 Length:285 Species:Rattus norvegicus


Alignment Length:146 Identity:34/146 - (23%)
Similarity:62/146 - (42%) Gaps:32/146 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LLQCNAYFSVAGFAE--------------------VNWLEANHVCNRVGAVLATVRNEEQHQLML 79
            |.|.||  |:||...                    .:|..:...|..:||.|..:.:..:.:.|.
  Rat   137 LTQFNA--SLAGLCRPCPWDWEFFQGSCYLFSRTLASWGASASSCKDLGAHLVIINSVAEQRFMK 199

  Fly    80 HYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDN 144
            ::..||     |:..|:|.::.: |...|.|:... |:.::.|...||.:|  |.:.|:.|..|.
  Rat   200 YWNVRK-----NQRSWIGLSDHL-REGSWQWVDHS-PLKFSFWKEGEPNND--GDEDCVELFMDE 255

  Fly   145 LWHSEPCQRKHNFICE 160
             |:...|.:::.::||
  Rat   256 -WNDNTCTQQNFWVCE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 25/130 (19%)
LOC100363064XP_038945816.1 CLECT_DC-SIGN_like 151..270 CDD:153060 25/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.