DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and dcsignlg

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_002660626.3 Gene:dcsignlg / 100320246 ZFINID:ZDB-GENE-090313-154 Length:263 Species:Danio rerio


Alignment Length:115 Identity:25/115 - (21%)
Similarity:48/115 - (41%) Gaps:13/115 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTG 114
            ::|.|:...|...||.|..:::||:.:.:...|....        |:|.:........|.|:...
Zfish   157 MSWSESRQFCRDRGADLVIIKSEEKQRFISSLVKEDT--------WIGLSVTETGGNKWKWVDNS 213

  Fly   115 IPVTYAQWSRREPKSDRTGQDACLVL----GTDNLWHSEPCQRKHNFICE 160
             |:....|::.||.:.:..::.|:.:    ||.|.|:...|......:||
Zfish   214 -PLNQGFWAKGEPNNYQGAKEDCVEVRISQGTPNNWNDRRCSDSRKAVCE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 23/113 (20%)
dcsignlgXP_002660626.3 CwlO1 <63..>148 CDD:443091
CLECT_DC-SIGN_like 144..263 CDD:153060 25/115 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.