DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and si:ch211-125e6.11

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001124136.1 Gene:si:ch211-125e6.11 / 100170830 ZFINID:ZDB-GENE-070912-35 Length:146 Species:Danio rerio


Alignment Length:134 Identity:32/134 - (23%)
Similarity:59/134 - (44%) Gaps:16/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRT 93
            |...|..::|..:||    ..|:|:.|...|...|..||:|.|..::..:::.|....|.     
Zfish    24 YGWINTGVKCYKFFS----QSVSWITAEKNCQGFGGNLASVHNRLENDFLMNMVPSSSRC----- 79

  Fly    94 FWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLG--TDNLWHSEPCQRKHN 156
             |:|..: .::...|.| :.|....|..|...||.:.|:  :.|:.:.  :::.|:.:.|.....
Zfish    80 -WIGGHD-GEQEGQWLW-TDGSMFDYNNWCSDEPNNQRS--ENCMEINWTSNHCWNDQGCSTSMG 139

  Fly   157 FICE 160
            |:||
Zfish   140 FMCE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 25/112 (22%)
si:ch211-125e6.11NP_001124136.1 CLECT 32..144 CDD:153057 30/126 (24%)

Return to query results.
Submit another query.