DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and si:ch211-125e6.11

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001124136.1 Gene:si:ch211-125e6.11 / 100170830 ZFINID:ZDB-GENE-070912-35 Length:146 Species:Danio rerio


Alignment Length:134 Identity:32/134 - (23%)
Similarity:59/134 - (44%) Gaps:16/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRT 93
            |...|..::|..:||    ..|:|:.|...|...|..||:|.|..::..:::.|....|.     
Zfish    24 YGWINTGVKCYKFFS----QSVSWITAEKNCQGFGGNLASVHNRLENDFLMNMVPSSSRC----- 79

  Fly    94 FWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLG--TDNLWHSEPCQRKHN 156
             |:|..: .::...|.| :.|....|..|...||.:.|:  :.|:.:.  :::.|:.:.|.....
Zfish    80 -WIGGHD-GEQEGQWLW-TDGSMFDYNNWCSDEPNNQRS--ENCMEINWTSNHCWNDQGCSTSMG 139

  Fly   157 FICE 160
            |:||
Zfish   140 FMCE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 25/112 (22%)
si:ch211-125e6.11NP_001124136.1 CLECT 32..144 CDD:153057 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5404
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0000269
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.