DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and MGC64513

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001123743.1 Gene:MGC64513 / 100170489 XenbaseID:XB-GENE-5829341 Length:160 Species:Xenopus tropicalis


Alignment Length:170 Identity:34/170 - (20%)
Similarity:68/170 - (40%) Gaps:37/170 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LPFLV----IASSNINNTDLT--------FYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRV- 62
            ||.|:    :|.||:......        |:.|.|    |..||..    .::|.||.:.|... 
 Frog     5 LPLLLLLGALAVSNVLEAAQVRSSCPNGWFFYKAN----CYGYFRY----PLSWSEAEYDCQAYG 61

  Fly    63 -GAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRRE 126
             ||.||::.:..:..::..::...:.   |:..|:|..: .:::..|.| :.|....|..|...:
 Frog    62 HGAHLASILDSAEADIIASHIAAYQT---NQPVWIGLHD-PEQNGRWKW-NDGSMYNYRSWLPGQ 121

  Fly   127 PKSDRT----GQDACLVLGTDNL--WHSEPCQRKHNFICE 160
            |.:..:    |:.:|    .:..  |:...|:....::|:
 Frog   122 PDNSNSAEYCGEMSC----RERFLKWNDSNCKAAKQYVCK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 21/118 (18%)
MGC64513NP_001123743.1 CLECT_REG-1_like 29..158 CDD:153064 28/146 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000269
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.