DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and hbl4

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001108197.1 Gene:hbl4 / 100137128 ZFINID:ZDB-GENE-070912-287 Length:245 Species:Danio rerio


Alignment Length:110 Identity:25/110 - (22%)
Similarity:51/110 - (46%) Gaps:7/110 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTGI 115
            |:..|...|:..||.:...|:|:::::::......|..:.:    :|||:.....:|......  
Zfish   142 NFETAQKFCSDAGAKIVLPRSEDENKVLISLQEALESTYVH----VGATDAKKEGHFVDLSDQ-- 200

  Fly   116 PVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            |:|:..|..:|| :|..|.:.|..:....:|:...|..|.:.:||
Zfish   201 PLTFTNWKEKEP-NDYNGAEDCTAVYKTGVWNDINCNSKWHVVCE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 23/108 (21%)
hbl4NP_001108197.1 Collagen 32..94 CDD:460189
CLECT_collectin_like 131..245 CDD:153061 25/110 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.