DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and mrc2

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_001344010.4 Gene:mrc2 / 100004793 ZFINID:ZDB-GENE-090915-5 Length:1473 Species:Danio rerio


Alignment Length:147 Identity:41/147 - (27%)
Similarity:66/147 - (44%) Gaps:23/147 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 INNTDLTFYQKCNPLLQCNAY-FSVAGFAEVNWLEANHVCNRVGA-VLATVRNEEQ---HQLMLH 80
            |.:.|...:...|.|:. |.| |:..  |.::|.||...|.:.|| :|:..:.|||   :.|::.
Zfish   235 IKSADCETFWDINSLMD-NCYQFNFQ--ATLSWSEARTSCQQQGADLLSITKVEEQIYVNGLLIG 296

  Fly    81 YVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTD-- 143
            |         :.|.|:|..:| |.:..|.|..:. |:.|..|....|..|.  ::.|.|:.||  
Zfish   297 Y---------SATLWMGLNDL-DLNGGWQWADSA-PLKYLNWEAEMPSYDE--EENCGVISTDAQ 348

  Fly   144 NLWHSEPCQRKHNFICE 160
            ..||:..|.....:||:
Zfish   349 GRWHNRDCSVALPYICK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 32/116 (28%)
mrc2XP_001344010.4 FN2 185..233 CDD:128373
CLECT 252..366 CDD:153057 37/129 (29%)
CLECT_DC-SIGN_like 388..512 CDD:153060
CLECT 526..650 CDD:214480
CLECT 674..806 CDD:214480
CLECT 826..948 CDD:214480
CLECT 969..1102 CDD:214480
CLECT 1132..1239 CDD:153057
CLECT 1255..1388 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.