DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and REG4

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001152824.1 Gene:REG4 / 83998 HGNCID:22977 Length:158 Species:Homo sapiens


Alignment Length:178 Identity:43/178 - (24%)
Similarity:74/178 - (41%) Gaps:29/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RSLFLVCLVFCSAWSLPESDLLPTSPAPGNDTAEEPQLPAFSPFSLRDGRFAIGAFAKV-NWFQA 65
            ||:.|:.|:.|.|.:....|::              ..|:.:|..........|.|.|: ||..|
Human     4 RSMRLLLLLSCLAKTGVLGDII--------------MRPSCAPGWFYHKSNCYGYFRKLRNWSDA 54

  Fly    66 QATCAAY--GYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWFSKGRA 128
            :..|.:|  |..|.||.|.::..::..::..|.|:|      |:|....|......|.|.. |..
Human    55 ELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQ------PIWIGLHDPQKRQQWQWID-GAM 112

  Fly   129 VNYRNFQNGLPGYSSDNRHCLGINGINGL--WVNENCSELRYFVCEKR 174
            ..||::.....|   .|:||..::..|..  |.:..|::.::|:|:.|
Human   113 YLYRSWSGKSMG---GNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 31/118 (26%)
REG4NP_001152824.1 CLECT_REG-1_like 30..156 CDD:153064 34/135 (25%)
Carbohydrate-binding 98..103 1/4 (25%)
Carbohydrate-binding 135..137 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5464
Isobase 1 0.950 - 0 Normalized mean entropy S6900
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.