DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and selp

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001230252.1 Gene:selp / 796481 ZFINID:ZDB-GENE-110107-2 Length:868 Species:Danio rerio


Alignment Length:136 Identity:29/136 - (21%)
Similarity:50/136 - (36%) Gaps:25/136 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GRFAIGAF-------AKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFL-FNYARNQQDLLTDP 106
            |.:.:.|:       :|::|..|:..|..:...:|:|.::.:...|...| |:.|.         
Zfish    19 GMYNVNAWTYHYNIDSKLDWTAARQWCQTHFTDMVAIQNQAEIAYLNEILPFHRAY--------- 74

  Fly   107 LWTSGTDLASDNNWVWF--SKGRAVNYRNFQNGLPGYSSDNRHCLGI----NGINGLWVNENCSE 165
            .|.....:  |.:|.|.  .|...|...|:....|........|:.|    |.....|.:|.||:
Zfish    75 YWIGIRKI--DGHWTWVGTKKRLTVEAANWATNEPNNQGTGEDCVEIYIKRNKDTAKWNDERCSK 137

  Fly   166 LRYFVC 171
            .:..||
Zfish   138 KKATVC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 27/120 (23%)
selpNP_001230252.1 CLECT_selectins_like 26..144 CDD:153062 27/129 (21%)
EGF_CA <153..178 CDD:238011
CCP <200..364 CDD:332582
CCP <324..489 CDD:332582
CCP 521..737 CDD:332582
CCP 751..806 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.