DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and LOC688858

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_038945829.1 Gene:LOC688858 / 688858 RGDID:1584108 Length:207 Species:Rattus norvegicus


Alignment Length:126 Identity:32/126 - (25%)
Similarity:49/126 - (38%) Gaps:36/126 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWFSK 125
            ||..:.|.|......||::.|:::|..|..||.|         ..|.|...:||..::.|.|.  
  Rat    97 NWNDSVAACQEVDAQLVTVESDEEQTFLDTFLKN---------KGPAWMGLSDLKQESTWQWV-- 150

  Fly   126 GRAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCSELR-------------YFVCEK 173
                      :|.|  .||:.....|.|......||:|:|||             :::|:|
  Rat   151 ----------DGSP--LSDSFRKYWIKGEPNNQGNEDCAELREDGWNDNKCDNKKFWICKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 31/124 (25%)
LOC688858XP_038945829.1 CLECT_DC-SIGN_like 77..199 CDD:153060 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.