DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and SFTPD

DIOPT Version :10

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_003010.4 Gene:SFTPD / 6441 HGNCID:10803 Length:375 Species:Homo sapiens


Alignment Length:142 Identity:37/142 - (26%)
Similarity:58/142 - (40%) Gaps:21/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AFSPF----------SLRDGRFAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNY 95
            |||.:          |:.:..|....|.| .:.:||..|...|..|.|..|..:..:|:..:  .
Human   244 AFSQYKKVELFPNGQSVGEKIFKTAGFVK-PFTEAQLLCTQAGGQLASPRSAAENAALQQLV--V 305

  Fly    96 ARNQQDLLTDPLWTSGTDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVN 160
            |:|:...|      |.||..::..:. :..|.::.|.|:..|.|.....:..|:.| ..||.|.:
Human   306 AKNEAAFL------SMTDSKTEGKFT-YPTGESLVYSNWAPGEPNDDGGSEDCVEI-FTNGKWND 362

  Fly   161 ENCSELRYFVCE 172
            ..|.|.|..|||
Human   363 RACGEKRLVVCE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 31/114 (27%)
SFTPDNP_003010.4 gly_rich_SclB <44..>220 CDD:468478
Surfac_D-trimer 224..269 CDD:286141 5/24 (21%)
CLECT_collectin_like 262..375 CDD:153061 33/124 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.