DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and REG1A

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_002900.2 Gene:REG1A / 5967 HGNCID:9951 Length:166 Species:Homo sapiens


Alignment Length:186 Identity:37/186 - (19%)
Similarity:67/186 - (36%) Gaps:48/186 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFLVCLVFCSAWSLPESDLLPTSPAPGNDTAEE-PQLPAFSPFSLRDGRFAIGAFA------KVN 61
            :.:.||:|             .|.:.|.:...| ||    :..|..:|..|..::.      :..
Human     9 MLISCLMF-------------LSQSQGQEAQTELPQ----ARISCPEGTNAYRSYCYYFNEDRET 56

  Fly    62 WFQAQATCAAYGY-TLVSITSEQDQRSLRNFL-------FNYARNQQDLLTDPLWTSGTDLASDN 118
            |..|...|..... .|||:.::.:...:.:.:       ||            :|....|...:.
Human    57 WVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFN------------VWIGLHDPKKNR 109

  Fly   119 NWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGL--WVNENCSELRYFVCE 172
            .|.| |.|..|:|:::..|.|. |.:..:|:.:....|.  |.:..|.:...|||:
Human   110 RWHW-SSGSLVSYKSWGIGAPS-SVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 26/124 (21%)
REG1ANP_002900.2 CLECT 36..164 CDD:321932 28/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5464
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.