DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and si:dkey-9i23.4

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001139080.1 Gene:si:dkey-9i23.4 / 571855 ZFINID:ZDB-GENE-090313-363 Length:189 Species:Danio rerio


Alignment Length:151 Identity:37/151 - (24%)
Similarity:68/151 - (45%) Gaps:25/151 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LPAFSPFSLRDGRFAIGAF-AKVNWFQAQATC--AAYGYTLVSITSEQDQRSLRNFLFNYARNQQ 100
            :|.||.: .|.|:..:..| :::|:.:|:.:|  .|....|||:.:.||..:|...:..:  |.:
Zfish    46 VPGFSDW-FRVGQRCVKYFSSRLNFTEAEFSCRTKAPRAHLVSVHNSQDNSNLLCIVKKF--NPK 107

  Fly   101 DLLTDPLWTSGTDLASDNNWVWFSKGRAVNYRNFQNGLPG-------YSSDNRHCLGINGIN-GL 157
            .|   .:|....:|.....:.|...    ::.||...:||       |:.:   |:.:|... |.
Zfish   108 SL---RIWLGAYELFQSGEFFWLDG----SFWNFNQWVPGEPNHMYTYTEE---CVEMNWREIGK 162

  Fly   158 WVNENCSELRYFVCE-KRCQF 177
            |.:..||..:.|:|. ||.:|
Zfish   163 WNDATCSVKKSFICAFKRKEF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 28/124 (23%)
si:dkey-9i23.4NP_001139080.1 CLECT 58..176 CDD:153057 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5404
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.