DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and si:ch211-225k7.6

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001093462.1 Gene:si:ch211-225k7.6 / 558654 ZFINID:ZDB-GENE-070705-121 Length:359 Species:Danio rerio


Alignment Length:116 Identity:26/116 - (22%)
Similarity:49/116 - (42%) Gaps:14/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWFS 124
            :||..||:.|......|||:.::.:.:.|..|:.:...::.|     :|     :....:|.|..
Zfish   136 MNWRAAQSYCRQNHIDLVSVRNQNESQQLEKFINDSIPSRSD-----VW-----IGLFRDWQWSD 190

  Fly   125 KGR-AVNYRNFQNGLPGYSSDNRHCLGI-NGINGLWVNENCSELRYFVCEK 173
            :.. :.:|.|...  |....:|.:|..: ...||.|.:.:|.....|||.:
Zfish   191 QSNYSFSYWNTNE--PNNYGNNENCTVLKENTNGHWADISCDCQFPFVCHE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 26/114 (23%)
si:ch211-225k7.6NP_001093462.1 CLECT 23..124 CDD:295302
CLECT 127..238 CDD:295302 25/113 (22%)
CLECT 244..356 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D605458at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.