DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and lectin-21Ca

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster


Alignment Length:114 Identity:28/114 - (24%)
Similarity:49/114 - (42%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWF 123
            ||:||:|.:.|...|..|::|.||.:..::|..|.:......|     .|....|:|....::..
  Fly   160 KVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHD-----FWLDINDIAKWGEFISL 219

  Fly   124 SKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCSELRYFVCE 172
            :.|....:..:....|......| |:.:.|  |..::..|||...|:|:
  Fly   220 ATGMNPPFLKWHKHRPQVQIHQR-CVHLRG--GEMMDGKCSEQFLFICQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 28/114 (25%)
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
33.010

Return to query results.
Submit another query.