DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and lectin-46Ca

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster


Alignment Length:145 Identity:44/145 - (30%)
Similarity:71/145 - (48%) Gaps:14/145 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EEPQLPAFSPFSLRD--GR-FAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYA 96
            |:.:.|...|: ||:  |: |.:| ..|:|||.||..|...|..|..:::.:|.::    :.:|.
  Fly    26 EKDKGPCGKPY-LRELNGKCFYVG-IKKINWFGAQNNCLRKGLNLADVSTMEDFKA----VVHYV 84

  Fly    97 RNQQDLLTDPLWTSGTDLASDNNWVWFSKGRAVNYRNFQNGL-PGYSSDNRHCLGINGINGLWV- 159
            .:|...  |..|..|.||.|:..:.:.|.|:.|.|....|.: |...|:...||.|.....:.| 
  Fly    85 TSQVGF--DDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVV 147

  Fly   160 -NENCSELRYFVCEK 173
             :.||.|.:||:||:
  Fly   148 LDVNCQEKKYFICEQ 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 35/116 (30%)
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 37/125 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.