DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and lectin-33A

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster


Alignment Length:132 Identity:27/132 - (20%)
Similarity:51/132 - (38%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PFSLRDGRFAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLW 108
            |||....:....:..:.||..|..:|...|..|:.:.:::|:.....||.:...:........:|
  Fly    27 PFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVW 91

  Fly   109 TSGTDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGL--WVNENCSELRYFVC 171
            .....|.:...::....|..|.|.|:....|..:|....|:|....||.  :.:..|.....:||
  Fly    92 AGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVC 156

  Fly   172 EK 173
            ::
  Fly   157 QR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 24/115 (21%)
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5404
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.