DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and KLRF1

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_057607.1 Gene:KLRF1 / 51348 HGNCID:13342 Length:231 Species:Homo sapiens


Alignment Length:129 Identity:28/129 - (21%)
Similarity:45/129 - (34%) Gaps:37/129 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KVNWF--QAQATCAAYGYTL-----VSITSEQ-----DQRSLRNFLFNY---ARNQQDLLTDPLW 108
            |..||  :.::...:|.|.|     :.|..:|     .|::||.  .||   ..|...|.....|
Human   124 KCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQ--LNYVWIGLNFTSLKMTWTW 186

  Fly   109 TSGTDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCSELRYFVCE 172
            ..|:.:.|.   ::|.||.|               ....|..|.  .....:|.||.:..::|:
Human   187 VDGSPIDSK---IFFIKGPA---------------KENSCAAIK--ESKIFSETCSSVFKWICQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 28/129 (22%)
KLRF1NP_057607.1 CLECT_NK_receptors_like 114..230 CDD:153063 27/127 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.