DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and CG14866

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001138057.1 Gene:CG14866 / 41854 FlyBaseID:FBgn0038315 Length:455 Species:Drosophila melanogaster


Alignment Length:184 Identity:31/184 - (16%)
Similarity:56/184 - (30%) Gaps:57/184 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PAPGNDTAEEPQLPAFSPFSLRDGRFAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNF 91
            |.|.|.|            .:.|..:.|.:..:|||..|.:.|......|.......:...:..:
  Fly   270 PCPANFT------------RISDNCYYINSQQQVNWKTANSACKGLNSHLAEFEKVSENEEIMAY 322

  Fly    92 LFNYARNQ-QDLLTDPLWTSGTDLASDNNWVWFSKGRAVN----------YRNFQNGLPGYSSDN 145
            |.|...:: :|     .|..|  |.....|:|.:..:.||          .:..:|.......|:
  Fly   323 LLNQPTHRGRD-----YWLGG--LNPGLLWIWSNSAKPVNPNMNLTSIAMAQKGENSTAANLVDS 380

  Fly   146 R-----------------------HCLGINGING----LWVNENCSELRYFVCE 172
            .                       .||.::...|    ::..:.|:...|::||
  Fly   381 SEQAAEEATGEDVLNNTVQIEGKGRCLRLSYNAGKHSYVYYGQECTSRHYYICE 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 25/152 (16%)
CG14866NP_001138057.1 CLECT 271..434 CDD:214480 28/181 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.