DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and MBL2

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_000233.1 Gene:MBL2 / 4153 HGNCID:6922 Length:248 Species:Homo sapiens


Alignment Length:128 Identity:28/128 - (21%)
Similarity:53/128 - (41%) Gaps:20/128 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FSLRDGRFAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWT 109
            |.|.:|.  |..|.||     :|.|..:..::.:..:..:..:::|           |:.:..:.
Human   138 FFLTNGE--IMTFEKV-----KALCVKFQASVATPRNAAENGAIQN-----------LIKEEAFL 184

  Fly   110 SGTDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCSELRYFVCE 172
            ..||..::..:|..: |..:.|.|:..|.|..:..:..|:.:.. ||.|.:..||.....|||
Human   185 GITDEKTEGQFVDLT-GNRLTYTNWNEGEPNNAGSDEDCVLLLK-NGQWNDVPCSTSHLAVCE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 23/114 (20%)
MBL2NP_000233.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..113
CLECT_collectin_like 136..246 CDD:153061 28/128 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.