DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and nw

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster


Alignment Length:146 Identity:35/146 - (23%)
Similarity:58/146 - (39%) Gaps:33/146 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWF 123
            ::|:|.|...|.:.|..|.|..:::...|:..:|.|......|     .||||..|.: ..::|.
  Fly    42 ELNYFLAYQYCRSLGLQLASFETKEKAESMTTYLKNAGYGNYD-----FWTSGNRLGT-GMFLWM 100

  Fly   124 SKGRAVN-----YRN----FQNGL-----------------PGYSSDNRHCLGINGINGLWVNEN 162
            |.|...|     :.|    .|.||                 ...|...:.|:.:......|:.|:
  Fly   101 STGLPFNATFDFFENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILKQPTLKWMPED 165

  Fly   163 CSELRYFVCEK-RCQF 177
            ||.::.|:||: ||.:
  Fly   166 CSAVKDFICEQTRCYY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 32/139 (23%)
nwNP_001027435.2 CLECT 31..176 CDD:153057 32/139 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.