DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and clec-32

DIOPT Version :10

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001023952.1 Gene:clec-32 / 3565962 WormBaseID:WBGene00009860 Length:365 Species:Caenorhabditis elegans


Alignment Length:197 Identity:45/197 - (22%)
Similarity:79/197 - (40%) Gaps:42/197 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FLVCLV-FCSAWSLPESDLLPTSPAPG---------NDTAEEPQLPAFSPFSLRDGRFAIGAFAK 59
            |||.|. |.:...:.|::::.:|..|.         :.:|....|...:|.::..   .:..|..
 Worm    49 FLVLLTYFLTKGRVYETEIVTSSTFPALPSTSSKADSTSASTTTLLTPAPSNINT---CVFGFTY 110

  Fly    60 VN---W---------FQAQATCAAY-GYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWT-- 109
            :|   |         ..|.:.|.:| |.||.||.:||:    .|.:|::..|..   .|..||  
 Worm   111 INGKCWRLFTDPQTRENADSVCMSYGGSTLFSIRNEQE----NNAIFDFVSNSS---VDYFWTGL 168

  Fly   110 --SGTDLASDNNWVWFSK-GRAVNYRNFQNGLPGYS-SDNRHCLGINGINGLWVNENCSELRYFV 170
              .|..::|   .:|..: |.|..|.||.:..|..: .:..:.:......|.|.:.:|:....|:
 Worm   169 ICKGNTISS---CIWDKESGSADGYDNFSDDYPDVAIGECVYFITTGSEAGKWKSGSCNPTMSFI 230

  Fly   171 CE 172
            ||
 Worm   231 CE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 33/133 (25%)
clec-32NP_001023952.1 CLECT 104..232 CDD:214480 32/137 (23%)
CLECT 249..356 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.