DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and CG11211

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster


Alignment Length:129 Identity:32/129 - (24%)
Similarity:56/129 - (43%) Gaps:6/129 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTD-PLWTSGTDLA 115
            |::..||:|||.:|...|...|..|.::.:|:..:    .:.:|...::.:..: ..|...|:|.
  Fly    42 FSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQ----LMLHYVNRKERIFGNRTFWLGATNLV 102

  Fly   116 SDNN-WVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCSELRYFVCEKRCQFD 178
            ..:. |.|.|.|..|.|..:....|......:....:.|.:.||.:|.|.....|:||..||.:
  Fly   103 DRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICENVCQLN 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 26/115 (23%)
CG11211NP_610208.1 CLECT 49..160 CDD:153057 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5404
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.