DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and CG15358

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster


Alignment Length:137 Identity:41/137 - (29%)
Similarity:63/137 - (45%) Gaps:16/137 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FSLRDGR-FAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLW 108
            |.|...| |.|....:.||..|.:.|...|..|.:|.|.::..:||..| |..|:        .|
  Fly   128 FELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKL-NKERH--------YW 183

  Fly   109 TSGTDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCSELRYFVCEK 173
            ...|||..:.::...:.|:..|:..::.|.|...|.|:||:.:  ::||..:..|..|.||:   
  Fly   184 LDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDL--LDGLMYDNKCESLSYFI--- 243

  Fly   174 RCQFDDD 180
             ||.|||
  Fly   244 -CQSDDD 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 31/113 (27%)
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.