DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and Reg3g

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_775120.1 Gene:Reg3g / 24620 RGDID:3256 Length:174 Species:Rattus norvegicus


Alignment Length:173 Identity:48/173 - (27%)
Similarity:73/173 - (42%) Gaps:26/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AWSLPESDLLPTSPAPGNDTAEEPQLPAFSPFSLRDGRFAIGAF------AKVNWFQAQATC--A 70
            :|.| .|.|:..|...|.|..|:  :|. |..|...|..|.|::      ...:||.|...|  .
  Rat    11 SWML-LSSLMLLSQVQGEDAKED--VPT-SRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKR 71

  Fly    71 AYGYTLVSITSEQDQRSLRNFLFNYARNQQDL---LTDPLWTSGTDLASDNNWVWFSKGRAVNYR 132
            ..|: |||:.|..:...:.:.:.:...:.|::   |.||  |.|.: .:...|.| |....:||.
  Rat    72 PSGH-LVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDP--TLGQE-PNRGGWEW-SNADVMNYF 131

  Fly   133 NFQNGLPGYSSDNRHCLGINGINGL--WVNENC-SELRYFVCE 172
            |::......|..  ||..:...:|.  |...|| |||.| ||:
  Rat   132 NWETNPSSVSGS--HCGTLTRASGFLRWRENNCISELPY-VCK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 34/122 (28%)
Reg3gNP_775120.1 CLECT_REG-1_like 40..172 CDD:153064 37/140 (26%)
EPN. /evidence=ECO:0000250 114..116 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I5395
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.