DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and Reg3b

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_445741.1 Gene:Reg3b / 24618 RGDID:3254 Length:180 Species:Rattus norvegicus


Alignment Length:186 Identity:47/186 - (25%)
Similarity:77/186 - (41%) Gaps:24/186 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSLFLVCLVF-CSAWSLPESDLLPTSPAPGNDTAEEPQLPAFSPFSLRDGRFAIGAFAKV---- 60
            ||...|..|.| ..:|.| .|.|:..|...|.|:.:  ::|: :..|...|..|.|::...    
  Rat     2 MRVKMLHRLAFPVMSWML-LSCLMLLSQVQGEDSPK--KIPS-ARISCPKGSQAYGSYCYALFQI 62

  Fly    61 --NWFQAQATC--AAYGYTLVSITSEQDQRSLRNFLFNYARNQQDL---LTDPLWTSGTDLASDN 118
              .||.|:..|  ...|: |||:.:..:...|.:.:.|...:.|..   |.||  |.|.: .:..
  Rat    63 PQTWFDAELACQKRPEGH-LVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDP--TLGGE-PNGG 123

  Fly   119 NWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGL--WVNENCSELRYFVCE 172
            .|.| |....:||.|::.. |..:.|...|..::..:|.  |.:..|.....:||:
  Rat   124 GWEW-SNNDIMNYVNWERN-PSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 30/127 (24%)
Reg3bNP_445741.1 CLECT_REG-1_like 45..178 CDD:153064 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I5395
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.