DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and FCER2

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001207429.1 Gene:FCER2 / 2208 HGNCID:3612 Length:321 Species:Homo sapiens


Alignment Length:113 Identity:30/113 - (26%)
Similarity:49/113 - (43%) Gaps:13/113 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 WFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWFSKG 126
            |..|:..|......||||.|.::|    :||..:|.:...      |....:|.....::|.. |
Human   184 WVHARYACDDMEGQLVSIHSPEEQ----DFLTKHASHTGS------WIGLRNLDLKGEFIWVD-G 237

  Fly   127 RAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCS-ELRYFVCEK 173
            ..|:|.|:..|.|...|....|:.:.| :|.|.:..|. :|..:||::
Human   238 SHVDYSNWAPGEPTSRSQGEDCVMMRG-SGRWNDAFCDRKLGAWVCDR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 30/111 (27%)
FCER2NP_001207429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..85
Repetitive region 69..89
RILP-like <77..153 CDD:304877
Repetitive region 90..110
Repetitive region 111..131
CLECT 163..282 CDD:214480 28/109 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.