DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and Reg3g

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_035390.1 Gene:Reg3g / 19695 MGIID:109406 Length:174 Species:Mus musculus


Alignment Length:129 Identity:38/129 - (29%)
Similarity:61/129 - (47%) Gaps:17/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FAIGAFAKVNWFQAQATC--AAYGYTLVSITSEQDQRSLRNFLFNYARNQQDL---LTDPLWTSG 111
            :|:.:.:| ||:.|...|  ...|: |||:.|..:...|.:.:.:...:.|.:   |.||  |.|
Mouse    52 YALFSVSK-NWYDADMACQKRPSGH-LVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDP--TLG 112

  Fly   112 TDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGL--WVNENCS-ELRYFVCE 172
            .: .:...|.| |....:||.|::.. |..||.| ||..::..:|.  |....|: ||.| ||:
Mouse   113 YE-PNRGGWEW-SNADVMNYINWETN-PSSSSGN-HCGTLSRASGFLKWRENYCNLELPY-VCK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 37/122 (30%)
Reg3gNP_035390.1 CLECT_REG-1_like 40..172 CDD:153064 38/129 (29%)
EPN. /evidence=ECO:0000250 114..116 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I5484
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.