DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and clec-4

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_496688.1 Gene:clec-4 / 189654 WormBaseID:WBGene00012583 Length:425 Species:Caenorhabditis elegans


Alignment Length:145 Identity:42/145 - (28%)
Similarity:71/145 - (48%) Gaps:13/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TAEEPQLP--AFSPFSLRDGRFAIGAFAKVNWF-QAQATCAAYGYTLVSITSEQDQRSLRNFLFN 94
            |..|...|  ..|.|:|.:|: .:..|..|:.. .|:.||..||.|||::.:..|.|::.:|..|
 Worm    17 TISEASYPPVCTSGFTLINGK-CLRIFVDVSTHTAAEKTCKGYGATLVTVKNSIDNRAIADFTGN 80

  Fly    95 YARNQQDLLTDPLWTSGTDLASDNNWVW-FSKGRAVNYRNFQNGLPGYSSDNRHCLGING-INGL 157
            .|    :|....|:...:|:   :..:| .:.|.|..|.||..|.|..:..|.....:.| :.|:
 Worm    81 NA----NLFWMGLYCFDSDV---SKCLWDDATGSAEVYDNFAAGFPHIALGNCVYYSVQGALAGM 138

  Fly   158 WVNENCSELRYFVCE 172
            |::.:|::.|.|:||
 Worm   139 WLSSDCNDRRSFICE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 34/117 (29%)
clec-4NP_496688.1 CLECT 27..153 CDD:214480 37/133 (28%)
CLECT 162..283 CDD:214480
CUB 309..415 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I7748
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.