DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and clec-127

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_494580.2 Gene:clec-127 / 189338 WormBaseID:WBGene00021138 Length:318 Species:Caenorhabditis elegans


Alignment Length:155 Identity:31/155 - (20%)
Similarity:53/155 - (34%) Gaps:45/155 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLPTSPAPGNDTAEEPQLP----AFSPFSLRDGRFAIGAFAKVNWFQAQA--TCAAYGYTLVSIT 80
            |.||.|.|    ..:|::.    .::.|:...|::.|..|...:..||.|  .|.:.|.||..:.
 Worm   131 LRPTKPRP----MTKPRVKVCPYGWATFNRPSGKWCIKVFIGHHAAQADAEEACRSIGTTLTGLQ 191

  Fly    81 SEQDQRSLRNFLFNYARNQQD-----------LLTDPL-----------WTSGTDLASDNNWVWF 123
            ::|:...::..|.:....|..           .:..||           ||..:...:|...   
 Worm   192 NKQEALFIQKSLLSLIPQQSGSVWLGLQRTARCMGQPLTATCSRTTAFEWTDNSATGTDGFL--- 253

  Fly   124 SKGRAVNYRNFQNGLPGYSSDNRHC 148
                      ||.|.|.....|::|
 Worm   254 ----------FQTGQPDNGRLNQNC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 21/114 (18%)
clec-127NP_494580.2 CLECT 147..274 CDD:214480 25/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.