DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and clec-38

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_507233.2 Gene:clec-38 / 188900 WormBaseID:WBGene00012025 Length:382 Species:Caenorhabditis elegans


Alignment Length:214 Identity:55/214 - (25%)
Similarity:84/214 - (39%) Gaps:62/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVCLVFCSAWSLPESDL--LP---TSPA--------------------------PGNDTAEEPQL 39
            ::.:||...:.:..:|.  ||   ||||                          |.|.|:  ...
 Worm    52 IIAIVFAILFFVGSADCAQLPDYTTSPASQLTTSAISSRTSEVQTNAITTTQGTPSNKTS--TTT 114

  Fly    40 PAFSPFSLRDGRFAIGA----FAKVNW--FQAQATCAAY-GYTLVSITSEQDQRSLRNFLFNYAR 97
            |:.|......|...:|.    ....|.  .:|.:.|..| |.||.|:.:||:.|.:.:|:     
 Worm   115 PSTSKVICASGFTLVGTKCGKLVSSNQPRTEADSICKGYGGSTLFSVRNEQETRDMLDFV----- 174

  Fly    98 NQQDLLTDPLWTS-GTDLASDNNWVWFSK-GRAVNYRNFQNGLP----GYSSDNRHCLG--INGI 154
              :|...|.|||. ..:..:..:.:|..| |...:|.||.:|.|    ||      |:.  :.|.
 Worm   175 --KDSNIDFLWTGLVCNQTARTSCIWDVKSGTTADYNNFADGFPNVVYGY------CIYFIVTGN 231

  Fly   155 N-GLWVNENCSELRYFVCE 172
            : |.|.:|.||:|..||||
 Worm   232 SAGQWGSEQCSQLMNFVCE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 39/126 (31%)
clec-38NP_507233.2 CLECT 122..250 CDD:214480 39/140 (28%)
CLECT 264..377 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I7748
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.