DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and clec-28

DIOPT Version :10

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001023950.1 Gene:clec-28 / 186005 WormBaseID:WBGene00009857 Length:402 Species:Caenorhabditis elegans


Alignment Length:115 Identity:35/115 - (30%)
Similarity:52/115 - (45%) Gaps:20/115 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNW--VWFSK-GR 127
            ||..:..|.||.||.::||.:::..||       :|...:.||| |.:....|.:  .|..| |.
 Worm   172 QACFSLGGSTLFSIRNDQDNQAVLEFL-------KDQHVENLWT-GLNCVGINPFTCTWDVKSGT 228

  Fly   128 AVNYRNFQNGLPGYSSDNRHCL-----GINGINGLWVNENCSELRYFVCE 172
            ...|.||.:|.|...:..  |:     |...  |.|.:.:|:|:..||||
 Worm   229 TSAYNNFADGYPNNMAGG--CIYYKTTGTQA--GQWSSGSCNEIMSFVCE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 35/115 (30%)
clec-28NP_001023950.1 CLECT 146..274 CDD:214480 33/113 (29%)
CLECT 288..396 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.