DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and clec-199

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001255942.1 Gene:clec-199 / 183064 WormBaseID:WBGene00007820 Length:667 Species:Caenorhabditis elegans


Alignment Length:125 Identity:28/125 - (22%)
Similarity:45/125 - (36%) Gaps:38/125 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWF 123
            ::|.|..:  |.:||..:..|...|....||.                  :.||::..:..|| .
 Worm   569 RLNDFNKE--CISYGGKIAEIPDAQVNDVLRK------------------SFGTNINDEEAWV-I 612

  Fly   124 SKGRAVNYRNFQNGLPGYSSDNRHCLG------INGI---NGLWVNENCSELRYF-VCEK 173
            |.|       :.|...||::....|:.      |:|.   .|.|....||..:.| :|:|
 Worm   613 SSG-------YNNVASGYTAAADSCIAMTLSQKISGSVAQRGTWRPYACSLAKNFGICQK 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 27/123 (22%)
clec-199NP_001255942.1 CLECT 99..210 CDD:214480
CLECT 549..664 CDD:214480 26/122 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.