DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and clec-52

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_501371.1 Gene:clec-52 / 181855 WormBaseID:WBGene00015052 Length:308 Species:Caenorhabditis elegans


Alignment Length:174 Identity:43/174 - (24%)
Similarity:66/174 - (37%) Gaps:33/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RSLFLVCLVFCSAWSLPESDLLPTSPAPGNDTAEEPQLPAFSPFSLRDGRFAIGAFAKVNWFQAQ 66
            |||.   ||||  :|.|   |:.....||            :.:.....|......|.|::..|:
 Worm     3 RSLL---LVFC--FSAP---LISAQCGPG------------ALYQQSSSRCLTLFRAAVDFQTAE 47

  Fly    67 ATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLW----TSGTDLASDNNWVWFSKGR 127
            :.||.....|||:.:..|    ..|:...|   |..:....|    .|..|:.:..||.| :.|.
 Worm    48 SICATLNGHLVSVHNAID----NTFVSGQA---QKFIDGGAWLGAQASAPDVTNPLNWYW-TDGT 104

  Fly   128 AVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCSELRYFVC 171
            ..||:|::.|.|..:.... |:.:......|...||:....|:|
 Worm   105 DFNYQNYKVGQPTQTGSTA-CMQLETGTSKWQTANCTTKLPFIC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 29/117 (25%)
clec-52NP_501371.1 CLECT 32..147 CDD:153057 30/123 (24%)
CLECT 166..303 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I4132
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.