DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and clec-48

DIOPT Version :10

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_507547.1 Gene:clec-48 / 180188 WormBaseID:WBGene00007565 Length:321 Species:Caenorhabditis elegans


Alignment Length:107 Identity:27/107 - (25%)
Similarity:43/107 - (40%) Gaps:6/107 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWFSKGRAV 129
            |:..|...|..|.|:.:.|:...|::   |.|.:.:.......|....||.:...|.|.......
 Worm    46 AEQQCNLLGGHLASVQNGQENALLQS---NAANSFKKSNYSDYWIGANDLETSGTWKWTDPSVTF 107

  Fly   130 NYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCSELRYFVC 171
            :|.|:|.|.|...||   |...:..:|.|....|:..|.::|
 Worm   108 DYSNWQLGEPQSGSD---CAIQDKGDGTWSAIGCTSYRPYLC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 27/107 (25%)
clec-48NP_507547.1 CLECT 26..146 CDD:214480 26/105 (25%)
CLECT 182..315 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.