Sequence 1: | NP_610207.1 | Gene: | CG8343 / 35544 | FlyBaseID: | FBgn0040502 | Length: | 182 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_507234.1 | Gene: | clec-34 / 180116 | WormBaseID: | WBGene00012023 | Length: | 363 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 52/199 - (26%) |
---|---|---|---|
Similarity: | 71/199 - (35%) | Gaps: | 49/199 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 SLPESDLLPTSPAPGNDTAEEPQLPAFSPFSLRDGRF--AIGAFAKVN---W---------FQAQ 66
Fly 67 ATCAAY-GYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDN-NWVW-FSKGRA 128
Fly 129 VNYRNFQNGLPGYSSDNRHCLGINGIN-GLWVNENCSELRYFVCE-------KRC---------- 175
Fly 176 QFDD 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8343 | NP_610207.1 | CLECT | 59..173 | CDD:153057 | 33/136 (24%) |
clec-34 | NP_507234.1 | CLECT | 104..232 | CDD:214480 | 34/135 (25%) |
CLECT | 246..356 | CDD:214480 | 2/11 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |