DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and clec-204

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_503499.2 Gene:clec-204 / 178656 WormBaseID:WBGene00021603 Length:551 Species:Caenorhabditis elegans


Alignment Length:174 Identity:42/174 - (24%)
Similarity:83/174 - (47%) Gaps:24/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLPTSPAPGNDTA--EEP---QLPAFSPF-SLRDGRFAIGAFAKVNWFQAQATCAA----YGYT- 75
            :|||.|.| |.|.  ::|   :...|..| ||.:.:....:..|..:..|:..|.:    :.:| 
 Worm   383 VLPTPPTP-NPTISWQDPCFYETTTFKYFESLHNAKCYRVSSEKKQFVDAENLCLSKHPLFLHTP 446

  Fly    76 -LVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSG--TDLASDNNWVWFSKGRAV--NYRNFQ 135
             |.||.::.::..:|..:     :.|.|:.:.::..|  .|.::.:|| :|..|...  :|:|::
 Worm   447 KLTSIETKIEEDQVRTLI-----HTQPLVNEGMFWFGLKRDPSNSSNW-YFINGDTYDSSYQNWR 505

  Fly   136 NGLPGYSSDNRHCLGINGINGLWVNENCSELRYFVCEKRCQFDD 179
            :|.| ..:|...|:.:...:..|||.:|::..|.:|..:..|.|
 Worm   506 SGYP-RDADGCDCVALVINDNSWVNTDCNKQLYSICAFQFNFTD 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 28/123 (23%)
clec-204NP_503499.2 CLECT <68..>116 CDD:295302
CLECT 414..540 CDD:214480 27/132 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.