DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and C49C3.11

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_503089.2 Gene:C49C3.11 / 178520 WormBaseID:WBGene00008201 Length:240 Species:Caenorhabditis elegans


Alignment Length:200 Identity:36/200 - (18%)
Similarity:68/200 - (34%) Gaps:45/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSLFLVCLVFCSAWSLPESDLLPTSPAPGNDTAEE--PQLPAFSPFSLRDGR--FAIGAF-AKV 60
            ||.|::      ||.:|..|.....:|..|:|..||  |..|....|..|:|:  :.:..| ...
 Worm     1 MRFLYI------SAVALVISVAAIGNPFGGDDKCEEGKPTCPPGYKFQEREGKRGWCLKYFPGNT 59

  Fly    61 NWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARN--QQDLLTDPLWTSG------------ 111
            .:.:|:..|...|.  .|::..::.:.|...:.....:  ::.:.|..:|...            
 Worm    60 TFEEAEKICRCQGG--ASLSGIENMKELTWVIVQAKASFAEEGIQTGGIWVGAYRRKACWDKKNL 122

  Fly   112 --TDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDN------RHC----------LGINGINGLW 158
              |:.:.:..:.|..:....|....:....|...||      .:|          |....:.|.:
 Worm   123 NKTECSKELQYQWTDRNTVGNLMWKKRWTAGAPHDNTVGDHHEYCVQLQVTVDPALANKNLTGFF 187

  Fly   159 VNENC 163
            .|..|
 Worm   188 DNRVC 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 17/136 (13%)
C49C3.11NP_503089.2 CLECT 50..210 CDD:153057 18/144 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.