DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and Fcer2

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001029096.1 Gene:Fcer2 / 171075 RGDID:619997 Length:331 Species:Rattus norvegicus


Alignment Length:118 Identity:35/118 - (29%)
Similarity:53/118 - (44%) Gaps:13/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 WFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWFSKG 126
            |.||:.||:.....||||.|:::|    :||..:...::.      |....||..:..:|| ..|
  Rat   207 WIQAKFTCSDLEGRLVSIHSQKEQ----DFLMQHINKKES------WIGLQDLNMEGEFVW-PDG 260

  Fly   127 RAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENC-SELRYFVCEKRCQFD 178
            ..|.|.|:..|.|........|:.:.| :|.|.:..| |.|..:|||:....|
  Rat   261 SPVGYSNWSPGEPNNGGQGEDCVMMRG-SGQWNDAFCRSYLDAWVCEQLATCD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 33/111 (30%)
Fcer2NP_001029096.1 RILP-like <60..170 CDD:304877
CLECT_DC-SIGN_like 186..306 CDD:153060 32/110 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.