DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and LOC110440085

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_021335186.1 Gene:LOC110440085 / 110440085 -ID:- Length:348 Species:Danio rerio


Alignment Length:148 Identity:28/148 - (18%)
Similarity:47/148 - (31%) Gaps:47/148 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NDTAEEPQLPAFSPFSLRDGRF-------AIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSL 88
            |.|.|..||...:    :||.|       .|.:..| :|.:::..|:..|..|:.:.:.::|..|
Zfish   220 NLTKERDQLQEKN----KDGWFYYQSSFYFISSEEK-SWSESRRYCSDRGADLIIVNNSEEQDIL 279

  Fly    89 RNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGING 153
            .......|          :|...|....:.:|.|..                         |.|.
Zfish   280 NKLSGRIA----------VWIGLTGSGKNRSWTWID-------------------------GTNM 309

  Fly   154 INGLWVNENCSELRYFVC 171
            ..|||.:...:|....:|
Zfish   310 TTGLWSHGEPNEAGGEIC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 19/113 (17%)
LOC110440085XP_021335186.1 SMC_N <8..>233 CDD:330553 5/16 (31%)
CLECT 234..336 CDD:321932 23/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D605458at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.